Structure of PDB 1izl Chain V

Receptor sequence

>1izlV (length=129) Species: 32053 (Thermostichus vulcanus)

ELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPS
LDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIF
PKMRNLTEKDLVAIAGHILVEPKILGDKW

3D structure

• PDB: 1izl Crystal structure of oxygen-evolving photosystem II from Thermosynechococcus vulcanus at 3.7-A resolution
• Chain: V
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	V	F33 C37 C40 H41 H92	F32 C36 C39 H40 H91

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0018063 cytochrome c-heme linkage
• GO:0019684 photosynthesis, light reaction
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009523 photosystem II
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:1izl, PDBe:1izl, PDBj:1izl
• PDBsum: 1izl
• PubMed: 12518057
• UniProt: P0A387|CY550_THEVL Photosystem II extrinsic protein V (Gene Name=psbV)