Structure of PDB 7ajt Chain UX

Receptor sequence
>7ajtUX (length=174) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TRKFGLVKRTLNTKKDQRLKKNQENTRNIPQVSSALFFQYNQAIKPPYQV
LIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRI
ALKLARDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIR
KIPGIPLMSVGGHAYVIEKLPDVF
3D structure
PDB7ajt Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
ChainUX
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna UX K112 R163 K166 H178 K97 R148 K151 H163
BS02 rna UX Q23 Y136 Q17 Y121
BS03 ZN UX C101 C130 H132 C140 C86 C115 H117 C125
Gene Ontology
Molecular Function
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ajt, PDBe:7ajt, PDBj:7ajt
PDBsum7ajt
PubMed33326748
UniProtQ05498|FCF1_YEAST rRNA-processing protein FCF1 (Gene Name=FCF1)

[Back to BioLiP]