Structure of PDB 6rxy Chain UX

Receptor sequence
>6rxyUX (length=190) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]
GVAKRTRKFATVKRIIGKQDERRKAEAVKKAEEEKRKKEKQAIREVPQMP
SSMFFEHNEALVPPYNVLVDTNFLSRTVGAKLPLLESAMDCLYASVNIII
TSCVMAELEKLGPRYRVALMIARDERWQRLTCDHKGTYADDCIVDRVQKH
RIYIVATNDRDLKRRIRKIPGVPIMSVQKGKYAIERLPGA
3D structure
PDB6rxy Thermophile 90S Pre-ribosome Structures Reveal the Reverse Order of Co-transcriptional 18S rRNA Subdomain Integration.
ChainUX
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna UX G-8 V-7 V3 K4 R5 R35 R155 R156 G1 V2 V12 K13 R14 R44 R164 R165
BS02 rna UX G-8 K-1 F0 R5 D11 E12 R27 K126 Y129 G1 K8 F9 R14 D20 E21 R36 K135 Y138
BS03 ZN UX C123 H125 C133 C132 H134 C142
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 14:44:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6rxy', asym_id = 'UX', title = 'Thermophile 90S Pre-ribosome Structures Reveal t...o-transcriptional 18S rRNA Subdomain Integration.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6rxy', asym_id='UX', title='Thermophile 90S Pre-ribosome Structures Reveal t...o-transcriptional 18S rRNA Subdomain Integration.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0032040', uniprot = '', pdbid = '6rxy', asym_id = 'UX'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0032040', uniprot='', pdbid='6rxy', asym_id='UX')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>