Structure of PDB 6d9j Chain UU

Receptor sequence

>6d9jUU (length=141) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

GVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENW
FYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARR
VLQALEGLKMVEKDQDWGRKLTPQGQRDLDRIAGQVAAAKK

3D structure

PDB

6d9j Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	UU	Q12 W33 V37 K38 L39 K43 E44 A46 P47 Y48 T55 R62 H63 R67 G71 V72 K77 Y79 R82 R84 G86 V87 P89 S90 H91 F92 S96 S98 R101 R102 Q105 R121 P125 Q128 R129 D132	Q10 W31 V35 K36 L37 K41 E42 A44 P45 Y46 T53 R60 H61 R65 G69 V70 K75 Y77 R80 R82 G84 V85 P87 S88 H89 F90 S94 S96 R99 R100 Q103 R119 P123 Q126 R127 D130

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6d9j, PDBe:6d9j, PDBj:6d9j
PDBsum	6d9j
PubMed	29856316
UniProt	G1TN62\|RS19_RABIT Small ribosomal subunit protein eS19 (Gene Name=RPS19)