Structure of PDB 7ajt Chain UN

Receptor sequence
>7ajtUN (length=147) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QRIQQRHDRKAAYEISRQEVSKWNDIVQQNRRADHLIFPLNKPTEHNHAS
AFTRTQDVPQTELQEKVDQVLQESQNVIINEKVNKKNLKYQSSAVPFPFE
NREQYERSLRMPIGQEWTSRASHQELIKPRIMTKPGQVIDPLKAPFK
3D structure
PDB7ajt Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
ChainUN
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna UN K834 V835 Q876 M884 K886 K82 V83 Q124 M132 K134
BS02 rna UN N299 Q303 R306 R307 F849 N24 Q28 R31 R32 F97
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
GO:0005524 ATP binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ajt, PDBe:7ajt, PDBj:7ajt
PDBsum7ajt
PubMed33326748
UniProtQ04500|UTP14_YEAST U3 small nucleolar RNA-associated protein 14 (Gene Name=UTP14)

[Back to BioLiP]