Structure of PDB 6zqe Chain UK

Receptor sequence

>6zqeUK (length=219) Species: 559292 (Saccharomyces cerevisiae S288C)

KLVHDVQKKQHRERSQLTSRSRYGFLEKHKDYVKRAQDFHRKQSTLKVLR
EKAKERNPDEYYHAMHSSMDQVKLLKTQDSNYVRTLRQIELKKLEKGAKQ
LMFKSSGNHTIFVDSREKMNEFTPEKFFNTTSEMVNRSENRLTKDQLANA
SSIMPKESLDKKKLKKFKQVKQHLQRETQLKQVQQRMDAQRELLKKGSKK
KIVDSSGKISFKWKKQRKR

3D structure

• PDB: 6zqe 90 S pre-ribosome transformation into the primordial 40 S subunit.
• Chain: UK
• Resolution: 7.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	UK	K3 V8 Q9 K10 K11 H13 R14 E15 R16	K1 V6 Q7 K8 K9 H11 R12 E13 R14
BS02	rna	UK	Q112 K116 R250	Q88 K92 R219

Gene Ontology

Molecular Function

• GO:0003674 molecular_function

Biological Process

• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6zqe, PDBe:6zqe, PDBj:6zqe
• PDBsum: 6zqe
• PubMed: 32943521
• UniProt: P34247|UTP11_YEAST U3 small nucleolar RNA-associated protein 11 (Gene Name=UTP11)