Structure of PDB 7aju Chain UI

Receptor sequence
>7ajuUI (length=88) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
DHLSKIFLTISKSITQNPWNEENLLPLWLKWLLTLKSGELNSIKDKHTKK
NCKHLKSALRSSEEILPVLLGIQGRLEMLRRQAKLRED
3D structure
PDB7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
ChainUI
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna UI K480 R487 K53 R60
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0005515 protein binding
GO:0034511 U3 snoRNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0071528 tRNA re-export from nucleus
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:0033553 rDNA heterochromatin
GO:0034455 t-UTP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aju, PDBe:7aju, PDBj:7aju
PDBsum7aju
PubMed33326748
UniProtP38882|UTP9_YEAST U3 small nucleolar RNA-associated protein 9 (Gene Name=UTP9)

[Back to BioLiP]