Structure of PDB 6zqb Chain UG

Receptor sequence

>6zqbUG (length=533) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

KERENQNKFERSTYQTKDKKLRAGLKKIDEQYKKAVSSAAATDYLLPESN
GYLEPENELEKTFKVQQSEIKSSVDVSTANKALDLSLKEFGPYHIKYAKN
GTHLLITGRKGHVASMDWRKGQLRAELFLNETCHSATYLQNEQYFAVAQK
KYTFIYDHEGTELHRLKQHIEARHLDFLPYHYLLVTAGETGWLKYHDVST
GQLVSELRTKAGPTMAMAQNPWNAVMHLGHSNGTVSLWSPSMPEPLVKLL
SARGPVNSIAIDRSGYYMATTGADRSMKIWDIRNFKQLHSVESLPTPGTN
VSISDTGLLALSRGPHVTLWKDALKLSGDSKPCFGSMGGNPHRNTPYMSH
LFAGNKVENLGFVPFEDLLGVGHQTGITNLIVPGAGEANYDALELNPFET
KKQRQEQEVRTLLNKLPADTITLDPNSIGSVDKRSSTIRLNAKDLAQTTM
DANNKAKTNSDIPDVKPDVKGKNSGLRSFLRKKTQNVIDERKLRVQKQLD
KEKNIRKRNHQIKQGLISEDHKDVIEEALSRFG

3D structure

PDB

6zqb 90 S pre-ribosome transformation into the primordial 40 S subunit.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	UG	K85 Q143 H179 I191 T211 W213 K215 L224 E227 R229 K231 R274 E313 H337 F355 G356 S357 M358 G359 G360 R364 A374 R425 Q426 D485 K487 K493 N494 G496 L497 R498 R502 K503 K524 R527 H531	K64 Q122 H158 I170 T190 W192 K194 L203 E206 R208 K210 R253 E292 H316 F334 G335 S336 M337 G338 G339 R343 A353 R404 Q405 D464 K466 K472 N473 G475 L476 R477 R481 K482 K503 R506 H510
BS02	rna	UG	D39 K40 K41 A44 K464	D18 K19 K20 A23 K443
BS03	rna	UG	L414 K423 Q424 R431	L393 K402 Q403 R410

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0030686	90S preribosome
GO:0030688	preribosome, small subunit precursor
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zqb, PDBe:6zqb, PDBj:6zqb
PDBsum	6zqb
PubMed	32943521
UniProt	P40055\|UTP7_YEAST U3 small nucleolar RNA-associated protein 7 (Gene Name=UTP7)

[Back to BioLiP]