Structure of PDB 6rxt Chain UG

Receptor sequence

>6rxtUG (length=479) Species: 209285 (Thermochaetoides thermophila)

KAELDRIRRYKQAQKKYGRGPRVDIKSVRDKKLRRTLTNLENKYKTAALK
AKEAEILLENQTGFLEPEGELERTYKVRQDEIVKEVAVEVAQKKFELKLT
ELGPYTCEYSRNGRDLILAGRKGHVATMDWREGKLGCELQLGETVRDARF
LHNNQFFAVAQKKYVYIYDHNGVEIHCLRKHVEVSHMEFLPYHFLLATLS
ISGQLKYQDTSTGQIVAEIATKHGTPVSLTQNPYNAILHIGQQNGTVTLW
SPNSTDPLVKLLAHRGPVRSLAVDREGRYMVSTGQDNKMCIWDIRNFKEA
VNSYFTRAPATSVAISDTGLTAVGWGTHTTIWKGLFNKERPVQVKVDSPY
MTWGGQGQVVERVRWCPFEDILGIGHNEGFSSIIVPGAGEANYDALEVNP
FETKKQRQEGEVKALLNKLQPEMIALDPNFIGNLDLRSEKQRQAERDLNT
ALKKYLRKQRKKNIIDEKRLKAEELYRQM

3D structure

• PDB: 6rxt Thermophile 90S Pre-ribosome Structures Reveal the Reverse Order of Co-transcriptional 18S rRNA Subdomain Integration.
• Chain: UG
• Resolution: 7.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	UG	D65 K66 K67 R70 R108 Y110 K169 Q190 K198 H205 R214 K215 E218 S237 Q249 I250 E253 T290 L297 R300 K323 S338 Y339 F340 R342 T362 H363 W367 K380 V381 D382 S383 P384 G392 K439 R442 Q443 R472 R477 R481 D482 K567 R570 K571 K574 K575	D30 K31 K32 R35 R73 Y75 K134 Q155 K163 H170 R179 K180 E183 S202 Q214 I215 E218 T255 L262 R265 K288 S303 Y304 F305 R307 T327 H328 W332 K345 V346 D347 S348 P349 G357 K404 R407 Q408 R437 R442 R446 D447 K454 R457 K458 K461 K462
BS02	rna	UG	N206 L431 K440 G445 Q455	N171 L396 K405 G410 Q420

Gene Ontology

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005730 nucleolus
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome

External links

• PDB: RCSB:6rxt, PDBe:6rxt, PDBj:6rxt
• PDBsum: 6rxt
• PubMed: 31378463
• UniProt: G0RZ99