Structure of PDB 6zqc Chain UF

Receptor sequence

>6zqcUF (length=293) Species: 559292 (Saccharomyces cerevisiae S288C)

SKTRYYLEQCIPEMDDLVEKGLFTKNEVSLIMKKRTDFEHRLNSRGSSIN
DYIKYINYESNVNKLRAKRCKRILQVKKTNSLSDWSIQQRIGFIYQRGTN
KFPQDLKFWAMYLNYMKARGNQTSYKKIHNIYNQLLKLHPTNVDIWISCA
KYEYEVHANFKSCRNIFQNGLRFNPDVPKLWYEYVKFELNFITKLINRRK
VMGLINALRGDIALTIFDVCMKTLGKHYINKHKSDSKMNIELNKETLNYL
FSESLRYIKLFERDYLINHVLQFWKNPELYLKTVMIDITLNIR

3D structure

• PDB: 6zqc 90 S pre-ribosome transformation into the primordial 40 S subunit.
• Chain: UF
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	UF	K3 Y6 Y7 Q10 R46 F94 K102	K2 Y5 Y6 Q9 R45 F93 K101

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0030515 snoRNA binding
• GO:0034511 U3 snoRNA binding
• GO:0042802 identical protein binding

Biological Process

• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:0034388 Pwp2p-containing subcomplex of 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6zqc, PDBe:6zqc, PDBj:6zqc
• PDBsum: 6zqc
• PubMed: 32943521
• UniProt: Q02354|UTP6_YEAST U3 small nucleolar RNA-associated protein 6 (Gene Name=UTP6)