Structure of PDB 7aju Chain UC |
>7ajuUC (length=86) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
TDRFKGDDDIDGKRAINYQILKNKGLTPKRNKDNRNSRVKKRKKYQKAQK KLKSVRAVYSGGQSGVYEGEKTGIKKGLTRSVKFKN |
|
PDB | 7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome. |
Chain | UC |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Biological Process |
GO:0000447 |
endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0000462 |
maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0000472 |
endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0000480 |
endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0006364 |
rRNA processing |
GO:0030490 |
maturation of SSU-rRNA |
GO:0042254 |
ribosome biogenesis |
|
|