Structure of PDB 5j4d Chain UC

Receptor sequence

>5j4dUC (length=155) Species: 262724 (Thermus thermophilus HB27)

ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW

3D structure

• PDB: 5j4d Structural Basis for Translation Termination on a Pseudouridylated Stop Codon.
• Chain: UC
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	UC	A2 R3 R4 R5 R6 A7 R10 L12 N28 K29 I30 M31 R32 D33 G34 K35 K36 N37 L38 R41 R76 R79 R94 R95 R102 R114 R115 A116	A1 R2 R3 R4 R5 A6 R9 L11 N27 K28 I29 M30 R31 D32 G33 K34 K35 N36 L37 R40 R75 R78 R93 R94 R101 R113 R114 A115
BS02	rna	UC	N84 Q86 R143 M144 A147	N83 Q85 R142 M143 A146
BS03	MG	UC	P88 M89 R155	P87 M88 R154

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5j4d, PDBe:5j4d, PDBj:5j4d
• PDBsum: 5j4d
• PubMed: 27107638
• UniProt: P62667|RS7_THET2 Small ribosomal subunit protein uS7 (Gene Name=rpsG)