Structure of PDB 6b4v Chain UB

Receptor sequence
>6b4vUB (length=137) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDKDRAAERAAKEEVQK
3D structure
PDB6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.
ChainUB
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna UB R108 R118 R108 R118
BS02 rna UB N2 R3 G4 R23 R53 R54 N58 R93 R95 R96 A97 K98 Y100 F101 K113 R115 K119 N2 R3 G4 R23 R53 R54 N58 R93 R95 R96 A97 K98 Y100 F101 K113 R115 K119
BS03 MG UB Q43 D44 F45 Q43 D44 F45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
PDBsum6b4v
PubMed29366636
UniProtQ72JU9|RL19_THET2 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]