Structure of PDB 5juu Chain UB

Receptor sequence

>5juuUB (length=144) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKG
IVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDE
VLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS

3D structure

PDB

5juu Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	UB	G2 K3 G4 K5 P6 R7 L9 N10 S11 R13 K14 R19 N22 R23 W24 A25 E26 L33 F38 K39 H48 A49 K50 K62 N65 S66 A67 I68 R69 K70 K78 P88 D90 G91 A105 G106 G108 R109 K112 K114 D116 I117 G119 R121	G1 K2 G3 K4 P5 R6 L8 N9 S10 R12 K13 R18 N21 R22 W23 A24 E25 L32 F37 K38 H47 A48 K49 K61 N64 S65 A66 I67 R68 K69 K77 P87 D89 G90 A104 G105 G107 R108 K111 K113 D115 I116 G118 R120

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006450	regulation of translational fidelity
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5juu, PDBe:5juu, PDBj:5juu
PDBsum	5juu
PubMed	27159452
UniProt	P0CX29\|RS23A_YEAST Small ribosomal subunit protein uS12A (Gene Name=RPS23A)