Structure of PDB 7ls1 Chain U3

Receptor sequence
>7ls1U3 (length=62) Species: 10090 (Mus musculus) [Search protein sequence]
KNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRH
YCGKCCLTYCFN
3D structure
PDB7ls1 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
ChainU3
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U3 K90 N91 H93 R95 K97 K99 L100 A101 V102 V130 F131 G133 H135 R138 Y140 K143 K1 N2 H4 R6 K8 K10 L11 A12 V13 V41 F42 G44 H46 R49 Y51 K54
BS02 ZN U3 C141 L146 C52 L57
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0043209 myelin sheath
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ls1, PDBe:7ls1, PDBj:7ls1
PDBsum7ls1
PubMed34815424
UniProtP62983|RS27A_MOUSE Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=Rps27a)

[Back to BioLiP]