Structure of PDB 6t59 Chain U3

Receptor sequence
>6t59U3 (length=102) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
QLLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSLERS
KSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTKESYELRYFQ
IN
3D structure
PDB6t59 TTC5 mediates autoregulation of tubulin via mRNA degradation.
ChainU3
Resolution3.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U3 K48 N50 G51 S79 K80 R81 Y82 K84 Y85 K88 K89 K92 R101 A104 R113 K32 N34 G35 S63 K64 R65 Y66 K68 Y69 K72 K73 K76 R85 A88 R97
BS02 peptide U3 Q116 I117 Q100 I101
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Apr 13 22:40:42 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6t59', asym_id = 'U3', title = 'TTC5 mediates autoregulation of tubulin via mRNA degradation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6t59', asym_id='U3', title='TTC5 mediates autoregulation of tubulin via mRNA degradation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6t59', asym_id = 'U3'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6t59', asym_id='U3')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>