Structure of PDB 7nwg Chain U2

Receptor sequence
>7nwgU2 (length=141) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
GVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENW
FYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARR
VLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAAKK
3D structure
PDB7nwg Blasticidin S inhibits mammalian translation and enhances production of protein encoded by nonsense mRNA.
ChainU2
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U2 V4 Q12 K43 E44 P47 Y48 R56 R62 R67 V72 S74 K77 I78 R82 M88 P89 H91 F92 S96 S98 R101 R121 P125 V2 Q10 K41 E42 P45 Y46 R54 R60 R65 V70 S72 K75 I76 R80 M86 P87 H89 F90 S94 S96 R99 R119 P123
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nwg, PDBe:7nwg, PDBj:7nwg
PDBsum7nwg
PubMed34157102
UniProtG1TN62|RS19_RABIT Small ribosomal subunit protein eS19 (Gene Name=RPS19)

[Back to BioLiP]