Structure of PDB 8wql Chain U1 |
>8wqlU1 (length=95) Species: 153964 (Arthrospira sp. FACHB-439) [Search protein sequence] |
ELNKADAKLGTEFGKKLDLNNSSIREFRQYPGMFPTLAKMIIDAAPYDSV QEVLEIPGLTDAQKEIIERYIGEFTITPVEPILQEGDFRLNTGVY |
|
PDB | 8wql Structure of in situ PBS-PSII supercomplex at 3.5 Angstroms resolution. |
Chain | U1 |
Resolution | 3.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
U1 |
F49 G50 |
F13 G14 |
|
|
|