Structure of PDB 8rct Chain U1

Receptor sequence
>8rctU1 (length=70) Species: 562 (Escherichia coli) [Search protein sequence]
PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKAS
AVKRHAKKLARENARRTRLY
3D structure
PDB8rct Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
ChainU1
Resolution5.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U1 R17 R21 R34 R35 Y38 K40 P41 T42 K46 A52 V53 R69 L70 Y71 R16 R20 R33 R34 Y37 K39 P40 T41 K45 A51 V52 R68 L69 Y70
BS02 rna U1 E24 R33 R62 E23 R32 R61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rct, PDBe:8rct, PDBj:8rct
PDBsum8rct
PubMed38409277
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]