Structure of PDB 7r81 Chain U1

Receptor sequence

>7r81U1 (length=173) Species: 5141 (Neurospora crassa) [Search protein sequence]

GRLQEYQVIGRHLPTESNPTPALYRMRIFAPNAVVAKSRFWYFLRGLRKV
KKATGEIVTCNVITEKHPLKVKNFGVWIRYDSRSGTHNMYKEYRELSRTA
AVEALYSDMAARHRARFRSIHILKVVELEKTEDIKRPYLKQLVTKKLSFP
LPHRVPKISNKKIFSAKRPATFA

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U1	G2 N62 T65 E66 K67 H68 P69 K71 S83 R84 S85 H88 M90 Y91 K92 A111 A112 R113 H114 R115 R117 R137 Y139 V144 T145 K146 P153 H154 N161 K163 A167 K168 A171 T172 F173	G1 N61 T64 E65 K66 H67 P68 K70 S82 R83 S84 H87 M89 Y90 K91 A110 A111 R112 H113 R114 R116 R136 Y138 V143 T144 K145 P152 H153 N160 K162 A166 K167 A170 T171 F172
BS02	rna	U1	S39 R40 Y43 R46 G47 K50 K52 K53 R84 R119	S38 R39 Y42 R45 G46 K49 K51 K52 R83 R118

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum	7r81
PubMed	34815343
UniProt	V5IQT8

[Back to BioLiP]