Structure of PDB 8yti Chain U

Receptor sequence
>8ytiU (length=87) Species: 9606 (Homo sapiens) [Search protein sequence]
KKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQ
NGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKK
3D structure
PDB8yti Linker Histones Associate Heterogeneously with Nucleosomes in the Condensed State
ChainU
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna U R57 N117 R24 N84
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0045296 cadherin binding
Biological Process
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8yti, PDBe:8yti, PDBj:8yti
PDBsum8yti
PubMed
UniProtQ92522|H1X_HUMAN Histone H1.10 (Gene Name=H1-10)

[Back to BioLiP]