Structure of PDB 8uqm Chain U

Receptor sequence
>8uqmU (length=82) Species: 562 (Escherichia coli) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA
3D structure
PDB8uqm Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
ChainU
Resolution5.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U M1 R5 L6 R8 H9 G10 A11 K12 K13 R14 F16 Y17 D23 R25 R28 G30 R31 R35 F38 I42 E47 R51 Q63 G64 S68 R70 M1 R5 L6 R8 H9 G10 A11 K12 K13 R14 F16 Y17 D23 R25 R28 G30 R31 R35 F38 I42 E47 R51 Q63 G64 S68 R70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uqm, PDBe:8uqm, PDBj:8uqm
PDBsum8uqm
PubMed39117885
UniProtC3SYP2

[Back to BioLiP]