Structure of PDB 8s1p Chain U

Receptor sequence
>8s1pU (length=102) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQA
NPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQV
LD
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
ChainU
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U H2 K4 K5 M10 I12 S13 G14 K15 A26 K29 V41 K42 K43 H44 S45 K46 P47 G55 I56 H64 S66 N67 M69 V78 R80 Y83 K90 K95 H2 K4 K5 M10 I12 S13 G14 K15 A26 K29 V41 K42 K43 H44 S45 K46 P47 G55 I56 H64 S66 N67 M69 V78 R80 Y83 K90 K95
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009295 nucleoid
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP0CI78|RL24_BACSU Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]