Structure of PDB 8pk0 Chain U

Receptor sequence
>8pk0U (length=152) Species: 9606 (Homo sapiens) [Search protein sequence]
ARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRV
DLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAH
GQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWF
GL
3D structure
PDB8pk0 Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.
ChainU
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U N4 L9 G32 Q35 Q41 R43 T49 R50 R69 R71 Q73 H74 N77 R79 R83 N84 K93 Y96 N3 L8 G31 Q34 Q40 R42 T48 R49 R68 R70 Q72 H73 N76 R78 R82 N83 K92 Y95
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0001650 fibrillar center
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pk0, PDBe:8pk0, PDBj:8pk0
PDBsum8pk0
PubMed38042949
UniProtQ16540|RM23_HUMAN Large ribosomal subunit protein uL23m (Gene Name=MRPL23)

[Back to BioLiP]