Structure of PDB 8oeq Chain U

Receptor sequence

>8oeqU (length=144) Species: 5476 (Candida albicans)

PLVVQEQGSFQHILRLLNTNIDGRIKIMYALTKIRGVGRRYANLVCKKAD
VELTKRAGELTQEELERIVTIMQNPTNYKIPAWFLNRQKDQVDGKDYHVL
ANNLESKLRDDLERLKKIRSHRGIRHFWGLKVRGQHTKTTSRGR

3D structure

• PDB: 8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: U
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	K27 Y30 G37 V38 G39 R40 R41 Y42 W84 F85 N87 R88 Q89 K90 Q92 L109 D112 H122 R123 R126 H127 K132 V133 R134 G135 Q136 H137 T138 K139 T140 T141 R143	K26 Y29 G36 V37 G38 R39 R40 Y41 W83 F84 N86 R87 Q88 K89 Q91 L108 D111 H121 R122 R125 H126 K131 V132 R133 G134 Q135 H136 T137 K138 T139 T140 R142

External links

• PDB: RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
• PDBsum: 8oeq
• UniProt: A0A8H6F3Y8