Structure of PDB 8imx Chain U

Receptor sequence

>8imxU (length=420) Species: 9606 (Homo sapiens)

AAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLL
DLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQD
FNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTI
LSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFV
PGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSW
DFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYT
IPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYRF
LRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILL
ISDYFYAFLRREYYLTHGLY

3D structure

• PDB: 8imx Structures of substrates- and products-bound glycosylphosphatidylinositol transamidase illuminate GPI-AP biogenesis
• Chain: U
• Resolution: 2.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	6OU	U	F342 N346 Y349 F356 T359	F341 N345 Y348 F355 T358
BS02	80T	U	L204 K216 M217 F222 W223 S226 W227 K309	L203 K215 M216 F221 W222 S225 W226 K308
BS03	Y01	U	I254 Y258 G259 L262	I253 Y257 G258 L261
BS04	Y01	U	L262 S263 S286 Q294 I295	L261 S262 S285 Q293 I294
BS05	Y01	U	W251 I254	W250 I253
BS06	Y01	U	L76 L82 V83	L75 L81 V82
BS07	81Q	U	I361 N385 A389 T393	I360 N384 A388 T392

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0034235 GPI anchor binding

Biological Process

• GO:0006091 generation of precursor metabolites and energy
• GO:0006506 GPI anchor biosynthetic process
• GO:0008218 bioluminescence
• GO:0016255 attachment of GPI anchor to protein
• GO:0046425 regulation of receptor signaling pathway via JAK-STAT

Cellular Component

• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0042765 GPI-anchor transamidase complex

External links

• PDB: RCSB:8imx, PDBe:8imx, PDBj:8imx
• PDBsum: 8imx
• PubMed: 37684232
• UniProt: Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein (Gene Name=PIGU)