Structure of PDB 8i0u Chain U

Receptor sequence
>8i0uU (length=72) Species: 9606 (Homo sapiens) [Search protein sequence]
MYNGIGLPTPRGSGTNGYVQRNLSLVPDILDHERKRRVELRCLELEEMME
EQGYEEQQIQEKVATFRLMLLE
3D structure
PDB8i0u Molecular basis for the activation of human spliceosome
ChainU
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U M1 I5 P10 T15 N16 Y18 R21 M1 I5 P10 T15 N16 Y18 R21
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0070742 C2H2 zinc finger domain binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0u, PDBe:8i0u, PDBj:8i0u
PDBsum8i0u
PubMed39068178
UniProtQ9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 (Gene Name=SRRM2)

[Back to BioLiP]