Structure of PDB 8htu Chain U

Receptor sequence

>8htuU (length=219) Species: 3218 (Physcomitrium patens) [Search protein sequence]

SIWYGADRPKYLGPFSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRE
LEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDYL
GNPSLVHAQSILAIWASQVVLMGAVEGYRVAGGPLGEITDPIYPGGSFDP
LGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHL
ADPVANNAWAYATNFVPGN

3D structure

PDB

8htu Structural insights into the assembly and energy transfer of the Lhcb9-dependent photosystem I from moss Physcomitrium patens.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	U	K56 Y57 L58 G59 W79	K10 Y11 L12 G13 W33
BS02	CLA	U	L69 G75 Y77 W79 D80 L84 S85 N94 R95 E98 H101 R218 M221 F222 F225	L23 G29 Y31 W33 D34 L38 S39 N48 R49 E52 H55 R172 M175 F176 F179
BS03	CLA	U	L97 H101 F228	L51 H55 F182
BS04	CLA	U	L107 G111 A133 Q136 Y145 L146	L61 G65 A87 Q90 Y99 L100
BS05	CHL	U	S150 L151 V152 H153 A154 Q155	S104 L105 V106 H107 A108 Q109
BS06	CHL	U	V152 I160 Q164 M168	V106 I114 Q118 M122
BS07	CHL	U	F131 K132 G134 A135 F138 Q164 I232	F85 K86 G88 A89 F92 Q118 I186
BS08	CHL	U	R103 V171 Y174 R175 G179 P180 L181 F194	R57 V125 Y128 R129 G133 P134 L135 F148
BS09	CHL	U	E96 L97 I100 H101 W104 Q164 M168 G169 E172 R175	E50 L51 I54 H55 W58 Q118 M122 G123 E126 R129
BS10	CLA	U	R103 M106 Y189 P190 G191 F194 L199 L209 E213	R57 M60 Y143 P144 G145 F148 L153 L163 E167
BS11	CLA	U	W49 K212 K215 N216	W3 K166 K169 N170
BS12	CLA	U	K212 N216 L219	K166 N170 L173
BS13	CLA	U	F222 G226 V229 Q230 T234 N241 H245 A254 Y257	F176 G180 V183 Q184 T188 N195 H199 A208 Y211
BS14	CLA	U	H245 P249	H199 P203
BS15	CHL	U	A258 V262	A212 V216

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8htu, PDBe:8htu, PDBj:8htu
PDBsum	8htu
PubMed	37474782
UniProt	A9RT62

[Back to BioLiP]