Structure of PDB 8hsp Chain U

Receptor sequence
>8hspU (length=70) Species: 562 (Escherichia coli) [Search protein sequence]
PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKAS
AVKRHAKKLARENARRTRLY
3D structure
PDB8hsp Structural insights into the decoding capability of isoleucine tRNAs with lysidine and agmatidine
ChainU
Resolution2.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U E31 R35 K40 P41 T42 R45 K46 K49 A52 V53 H56 R69 Y71 E30 R34 K39 P40 T41 R44 K45 K48 A51 V52 H55 R68 Y70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hsp, PDBe:8hsp, PDBj:8hsp
PDBsum8hsp
PubMed38538915
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]