Structure of PDB 8fug Chain U |
>8fugU (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] |
VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIG SLDNITHVPGGGNKKIETHKLTF |
|
PDB | 8fug Stacked binding of a PET ligand to Alzheimer's tau paired helical filaments. |
Chain | U |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
Y9H |
U |
Q351 S352 K353 |
Q46 S47 K48 |
|
|
|
|