Structure of PDB 8esr Chain U |
>8esrU (length=98) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] |
SNKYIIDATAAVNDKIFDVAAFEKYLIDRIKVDGKTGNLGSSVVVSREGS SKIAVIAHIDFSGRYLKYLTKKFLKKHSLRDWLRVVSTKKGVYELRYY |
|
PDB | 8esr Chromatin localization of nucleophosmin organizes ribosome biogenesis. |
Chain | U |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
U |
Y73 S95 |
Y65 S87 |
|
|
|
|