Structure of PDB 8cgu Chain U

Receptor sequence
>8cguU (length=47) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
PVIVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHA
3D structure
PDB8cgu Structural conservation of antibiotic interaction with ribosomes.
ChainU
Resolution1.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U E31 R35 K40 P41 T42 R45 K46 A52 V53 K54 R55 H56 E21 R25 K30 P31 T32 R35 K36 A42 V43 K44 R45 H46
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cgu, PDBe:8cgu, PDBj:8cgu
PDBsum8cgu
PubMed37550453
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]