Structure of PDB 8ba0 Chain U

Receptor sequence

>8ba0U (length=85) Species: 7227 (Drosophila melanogaster)

PPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMA
MEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE

3D structure

• PDB: 8ba0 Cryo-EM structures of mitochondrial respiratory complex I from Drosophila melanogaster.
• Chain: U
• Resolution: 3.68 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EHZ	U	D107 S108	D40 S41

Gene Ontology

Molecular Function

• GO:0000035 acyl binding
• GO:0000036 acyl carrier activity

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0006633 fatty acid biosynthetic process
• GO:0032981 mitochondrial respiratory chain complex I assembly

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045271 respiratory chain complex I
• GO:0099128 mitochondrial [2Fe-2S] assembly complex
• GO:1902494 catalytic complex

External links

• PDB: RCSB:8ba0, PDBe:8ba0, PDBj:8ba0
• PDBsum: 8ba0
• PubMed: 36622099
• UniProt: Q94519|ACPM_DROME Acyl carrier protein, mitochondrial (Gene Name=ND-ACP)