Structure of PDB 8azw Chain U

Receptor sequence
>8azwU (length=98) Species: 4097 (Nicotiana tabacum) [Search protein sequence]
QPNTGLSVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRSLIREVAGFA
PYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNALRKMRA
3D structure
PDB8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
ChainU
Resolution2.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U G17 H18 V20 R28 P29 S30 R32 K33 G34 T36 S37 K38 R39 R44 Y56 K70 R71 R78 K79 G81 H83 K84 R85 K87 K88 K89 G13 H14 V16 R24 P25 S26 R28 K29 G30 T32 S33 K34 R35 R40 Y52 K66 R67 R74 K75 G77 H79 K80 R81 K83 K84 K85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8azw, PDBe:8azw, PDBj:8azw
PDBsum8azw
PubMed37156858
UniProtA0A1S4D2I2

[Back to BioLiP]