Structure of PDB 8auv Chain U

Receptor sequence

>8auvU (length=142) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

SLVANEEFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADID
MNKRAGELSAAELDSLMVVVANPRQFKIPDWFLNRQKDYKDGKFSQVTSN
ALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRG

3D structure

PDB

8auv Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.38 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	K25 F28 G35 I36 G37 R39 F40 R55 W82 F83 N85 Q87 K88 Q97 L107 D110 H120 R121 H125 R130 V131 R132 G133 Q134 H135 T136 K137 T138 T139 G140 R141 R142 G143	K24 F27 G34 I35 G36 R38 F39 R54 W81 F82 N84 Q86 K87 Q96 L106 D109 H119 R120 H124 R129 V130 R131 G132 Q133 H134 T135 K136 T137 T138 G139 R140 R141 G142
BS02	MG	U	T31 I33 I36	T30 I32 I35

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

External links