Structure of PDB 8a5y Chain U

Receptor sequence
>8a5yU (length=114) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MKVKINEVHSVFAWSWHIPSDEDVCGICRASYNGTCPSCKFPGDQCPLVI
GLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVE
IVSRRREEMIEEGV
3D structure
PDB8a5y Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex and comparison to apo unphosphorylated and phosphorylated states
ChainU
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 6.3.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN U C55 C62 H76 C39 C46 H60
BS02 ZN U C69 H71 C91 C94 C53 H55 C75 C78
BS03 ZN U C41 C44 H74 C77 C25 C28 H58 C61
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0016874 ligase activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
GO:0097602 cullin family protein binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0031145 anaphase-promoting complex-dependent catabolic process
GO:0045842 positive regulation of mitotic metaphase/anaphase transition
GO:0051301 cell division
GO:0051445 regulation of meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005680 anaphase-promoting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a5y, PDBe:8a5y, PDBj:8a5y
PDBsum8a5y
PubMed
UniProtQ12157|APC11_YEAST Anaphase-promoting complex subunit 11 (Gene Name=APC11)

[Back to BioLiP]