Structure of PDB 7zwc Chain U |
>7zwcU (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] |
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMENVVVCQ YDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW |
|
PDB | 7zwc Structural basis of SNAPc-dependent snRNA transcription initiation by RNA polymerase II. |
Chain | U |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
U |
R344 K346 |
R56 K58 |
|
|
|
|