Structure of PDB 7zs9 Chain U |
>7zs9U (length=107) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
NAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVT TFSWDYLISPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKA QVEAEWV |
|
PDB | 7zs9 Structures of transcription preinitiation complex engaged with the +1 nucleosome. |
Chain | U |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
U |
R253 K255 |
R74 K76 |
|
|
|
|