Structure of PDB 7xvm Chain U

Receptor sequence
>7xvmU (length=86) Species: 9031 (Gallus gallus) [Search protein sequence]
SRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQI
KLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAKRS
3D structure
PDB7xvm Crystal Structure of Nucleosome-H1.0 Linker Histone Assembly (sticky-169a DNA fragment)
ChainU
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna U R48 R74 A90 R95 R29 R55 A71 R76
BS02 dna U H26 T28 Y29 R43 S47 Q49 K53 H63 N64 G92 S93 H7 T9 Y10 R24 S28 Q30 K34 H44 N45 G73 S74
BS03 dna U S25 A35 R38 Y59 K60 K103 R104 S6 A16 R19 Y40 K41 K84 R85
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xvm, PDBe:7xvm, PDBj:7xvm
PDBsum7xvm
PubMed
UniProtP02259|H5_CHICK Histone H5

[Back to BioLiP]