Structure of PDB 7wld Chain U

Receptor sequence

>7wldU (length=419) Species: 9606 (Homo sapiens)

AAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLL
DLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQD
FNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTI
LSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFV
PGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSW
DFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYT
IPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYRF
LRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILL
ISDYFYAFLRREYYLTHGL

3D structure

• PDB: 7wld Molecular insights into biogenesis of glycosylphosphatidylinositol anchor proteins.
• Chain: U
• Resolution: 2.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	U	I295 N296 F299	I294 N295 F298
BS02	Y01	U	I254 Y258 G259	I253 Y257 G258
BS03	CLR	U	M232 G235 S236 V239	M231 G234 S235 V238
BS04	CLR	U	L90 F97 L172 K176	L89 F96 L171 K175
BS05	DKB	U	Y149 M339 N346 F356 T359	Y148 M338 N345 F355 T358
BS06	Y01	U	L262 L287 V290 C291 Q294 I295 F298	L261 L286 V289 C290 Q293 I294 F297
BS07	06O	U	N385 F386 A389 T393	N384 F385 A388 T392

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0034235 GPI anchor binding

Biological Process

• GO:0006091 generation of precursor metabolites and energy
• GO:0006506 GPI anchor biosynthetic process
• GO:0008218 bioluminescence
• GO:0016255 attachment of GPI anchor to protein
• GO:0046425 regulation of receptor signaling pathway via JAK-STAT

Cellular Component

• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0042765 GPI-anchor transamidase complex

External links

• PDB: RCSB:7wld, PDBe:7wld, PDBj:7wld
• PDBsum: 7wld
• PubMed: 35551457
• UniProt: Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein (Gene Name=PIGU)