Structure of PDB 7uti Chain U

Receptor sequence
>7utiU (length=160) Species: 9606 (Homo sapiens) [Search protein sequence]
DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQN
PTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLF
RMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYD
EFLEFMKGVE
3D structure
PDB7uti Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
ChainU
Resolution4.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA U D65 D67 S69 T71 E76 D64 D66 S68 T70 E75
BS02 CA U D141 N143 D145 R147 E152 D140 N142 D144 R146 E151
BS03 CA U D105 N107 D109 Y111 E116 D104 N106 D108 Y110 E115
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0031013 troponin I binding
GO:0031014 troponin T binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0051015 actin filament binding
Biological Process
GO:0002086 diaphragm contraction
GO:0003009 skeletal muscle contraction
GO:0006937 regulation of muscle contraction
GO:0010038 response to metal ion
GO:0014883 transition between fast and slow fiber
GO:0032972 regulation of muscle filament sliding speed
GO:0043462 regulation of ATP-dependent activity
GO:0055010 ventricular cardiac muscle tissue morphogenesis
GO:0060048 cardiac muscle contraction
Cellular Component
GO:0005829 cytosol
GO:0005861 troponin complex
GO:0043292 contractile muscle fiber
GO:1990584 cardiac Troponin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uti, PDBe:7uti, PDBj:7uti
PDBsum7uti
PubMed32521240
UniProtP63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles (Gene Name=TNNC1)

[Back to BioLiP]