Structure of PDB 7umh Chain U

Receptor sequence

>7umhU (length=153) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]

NQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVG
MAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTF
QGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRG
LFN

3D structure

PDB

7umh Energetic robustness to large scale structural fluctuations in a photosynthetic supercomplex.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	U	Y59 L141 I151	Y55 L137 I147
BS02	CLA	U	W65 P70 I83 A87	W61 P66 I79 A83
BS03	CLA	U	T22 I24 S25	T18 I20 S21
BS04	CLA	U	P64 W65 L68 P70	P60 W61 L64 P66
BS05	ECH	U	W65 A87	W61 A83
BS06	CLA	U	F33 N36 L37 R41 E52 M55	F29 N32 L33 R37 E48 M51
BS07	CLA	U	F33 L37 P38 A39 V53 A56 H57 F60	F29 L33 P34 A35 V49 A52 H53 F56
BS08	CLA	U	Y59 F60 G63 P64 L67 L141 L142 L145 F152	Y55 F56 G59 P60 L63 L137 L138 L141 F148
BS09	CA	U	F156 N157	F152 N153
BS10	CLA	U	L90 T93 S97 F128	L86 T89 S93 F124
BS11	CA	U	P70 D73	P66 D69

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0005886	plasma membrane
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7umh, PDBe:7umh, PDBj:7umh
PDBsum	7umh
PubMed	37532717
UniProt	P37277\|PSAL_SYNY3 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]