Structure of PDB 7syk Chain U

Receptor sequence

>7sykU (length=141) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

GVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENW
FYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARR
VLQALEGLKMVEKDQDWGRKLTPQGQRDLDRIAGQVAAAKK

3D structure

PDB

7syk Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.

Chain

Resolution

4.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	G3 T5 Q12 K38 L39 K41 K43 E44 L45 P47 R56 R62 H63 R67 G71 V72 G73 S74 K77 I78 Y79 G80 R82 R84 G86 V87 M88 P89 H91 F92 S96 K97 S98 R101 Q105 P125 Q128 R129 R133	G1 T3 Q10 K36 L37 K39 K41 E42 L43 P45 R54 R60 H61 R65 G69 V70 G71 S72 K75 I76 Y77 G78 R80 R82 G84 V85 M86 P87 H89 F90 S94 K95 S96 R99 Q103 P123 Q126 R127 R131

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7syk, PDBe:7syk, PDBj:7syk
PDBsum	7syk
PubMed	35822879
UniProt	G1TN62\|RS19_RABIT Small ribosomal subunit protein eS19 (Gene Name=RPS19)