Structure of PDB 7ryg Chain U

Receptor sequence
>7rygU (length=97) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
ANFVLNAQARAEDKQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELREL
VKALESNVFFEEVVEIKVGDKVENVKIQALQRHPAKNTPMHADFKRA
3D structure
PDB7ryg An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
ChainU
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U R11 Q16 K18 R23 R25 R26 Y35 P41 Q82 H92 R10 Q15 K17 R22 R24 R25 Y34 P40 Q81 H91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ryg, PDBe:7ryg, PDBj:7ryg
PDBsum7ryg
PubMed35100868
UniProtB7I7B6|RL25_ACIB5 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]