Structure of PDB 7rcv Chain U |
>7rcvU (length=95) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence] |
ELNAVDAKLTTDFGQKIDLNNSDIRDFRGLRGFYPNLASEIIKNAPYDTV EEVLDIPGLSETQKSRLEANLGSFTVTEPSIELTSGDDRINPGVY |
|
PDB | 7rcv High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803. |
Chain | U |
Resolution | 2.01 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
U |
D59 D62 |
D23 D26 |
|
|
|
|