Structure of PDB 7q0r Chain U

Receptor sequence

>7q0rU (length=141) Species: 237561 (Candida albicans SC5314)

PGVSVRDVPAQDFINAYAQFLQRQGKLEVPGYVDIVKTSAGNDLPPQEAE
TWFYKRAASIARHIYLRKQVGVGALNKLYGGAKNRGFRPHKHVDASGSIN
RKCVQALQKIGVLEISPKGGRRISENGQRDLDRIAAQTLEE

3D structure

• PDB: 7q0r E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: U
• Resolution: 2.67 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	P2 G3 R7 A11 I15 V37 K38 T39 A41 N43 D44 L45 Q48 R57 S60 R63 H64 R68 K69 V73 G74 K78 G81 K84 N85 R86 G87 F88 R89 P90 H91 K92 H93 S97 G98 S99 R102 Q106 G121 R122 E126 Q129 D133	P1 G2 R6 A10 I14 V36 K37 T38 A40 N42 D43 L44 Q47 R56 S59 R62 H63 R67 K68 V72 G73 K77 G80 K83 N84 R85 G86 F87 R88 P89 H90 K91 H92 S96 G97 S98 R101 Q105 G120 R121 E125 Q128 D132

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q0r, PDBe:7q0r, PDBj:7q0r
• PDBsum: 7q0r
• PubMed: 35613268
• UniProt: A0A1D8PK61|RS19A_CANAL Small ribosomal subunit protein eS19 (Gene Name=RPS19A)