Structure of PDB 7p3k Chain U

Receptor sequence
>7p3kU (length=70) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKAS
AVKRHAKKLARENARRTRLY
3D structure
PDB7p3k Structural basis of l-tryptophan-dependent inhibition of release factor 2 by the TnaC arrest peptide.
ChainU
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U E31 R35 K40 T42 K46 R47 A52 V53 H56 R69 Y71 E30 R34 K39 T41 K45 R46 A51 V52 H55 R68 Y70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p3k, PDBe:7p3k, PDBj:7p3k
PDBsum7p3k
PubMed34403461
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]