Structure of PDB 7ozp Chain U

Receptor sequence

>7ozpU (length=114) Species: 9825 (Sus scrofa domesticus) [Search protein sequence]

VGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHE
VDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLY
YVCTAPHCGHRWTE

3D structure

PDB

7ozp Structure of an inactive RNA polymerase II dimer.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	U	C39 C42	C28 C31
BS02	ZN	U	C86 C89 C114 C119	C75 C78 C103 C108

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0001193	maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006283	transcription-coupled nucleotide-excision repair
GO:0006351	DNA-templated transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005730	nucleolus

External links

PDB	RCSB:7ozp, PDBe:7ozp, PDBj:7ozp
PDBsum	7ozp
PubMed	34530439
UniProt	P60899\|RPB9_PIG DNA-directed RNA polymerase II subunit RPB9 (Gene Name=POLR2I)