Structure of PDB 7ml1 Chain U

Receptor sequence
>7ml1U (length=44) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
LMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
3D structure
PDB7ml1 Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
ChainU
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna U T254 R257 T12 R15
BS02 dna U K250 K255 K8 K13
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003712 transcription coregulator activity
GO:0005515 protein binding
GO:0017025 TBP-class protein binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005672 transcription factor TFIIA complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ml1, PDBe:7ml1, PDBj:7ml1
PDBsum7ml1
PubMed35051353
UniProtP32773|TOA1_YEAST Transcription initiation factor IIA large subunit (Gene Name=TOA1)

[Back to BioLiP]