Structure of PDB 7k60 Chain U

Receptor sequence
>7k60U (length=76) Species: 9606 (Homo sapiens) [Search protein sequence]
QPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSI
KALVQNDTLLQVKGTGANGSFKLNRK
3D structure
PDB7k60 Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
ChainU
Resolution3.12 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna U P44 G45 K46 Y47 S48 S65 Y87 K105 G111 S112 P2 G3 K4 Y5 S6 S23 Y45 K63 G69 S70
BS02 dna U Q43 Q82 N83 R85 K89 Y90 K93 N110 Q1 Q40 N41 R43 K47 Y48 K51 N68
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0045296 cadherin binding
Biological Process
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7k60, PDBe:7k60, PDBj:7k60
PDBsum7k60
PubMed33238161
UniProtQ92522|H1X_HUMAN Histone H1.10 (Gene Name=H1-10)

[Back to BioLiP]